Scaffold Ga0103880_10012383

Overview

Basic Information

• Taxon OID: 3300009279
• Scaffold ID: Ga0103880_10012383
• Source Dataset Name: Eukaryotic communities of water from the North Atlantic ocean - ACM42
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Georgia
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 864
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Eukaryotic Communities Of Water From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location

• Location Name: North Pacific Ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068737	Metatranscriptome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103880_100123831	F068737	N/A	ADMTGGMCFMMFMSGAEEKLSCIERTACEDPYLATDYLTAAKMIYKGYKLVGMHIADKYATVMNSVNDAMEYGKAGNDCSQKYHW*