Scaffold Ga0103879_10031562

Overview

Basic Information

• Taxon OID: 3300009276
• Scaffold ID: Ga0103879_10031562
• Source Dataset Name: Eukaryotic communities of water from the North Atlantic ocean - ACM57
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Georgia
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 586
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Suessiaceae → Polarella → Polarella glacialis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Eukaryotic Communities Of Water From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location

• Location Name: North Pacific Ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074919	Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103879_100315621	F074919	N/A	GDKKPDWFKAMKNKRNMTVDHYTKWFLHLFVDADPESPTYRQPVRFYGPYSGFAVYKSVVAGVPPAEVWDTACVDNGWGTHEIKPLHPCRGKKLDTYKCMNVEKKDPEVCKPWEHGAGSADIDTRLKGAFGDIIIPQVEKMVV*