Scaffold Ga0103879_10002708

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103879_10002708

Scaffold Ga0103879_10002708

Overview

Basic Information
Taxon OID	3300009276 Open in IMG/M
Scaffold ID	Ga0103879_10002708 Open in IMG/M
Source Dataset Name	Eukaryotic communities of water from the North Atlantic ocean - ACM57
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	University of Georgia
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	934
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Eukaryotic Communities Of Water From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location
Location Name	North Pacific Ocean
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002472	Metatranscriptome	556	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103879_100027081	F002472	GGA	VALSKNQVRSIHGTDAGAGGGGWPTVRIYNKETGYGGKAYEKKTSEAMCDELGPKNEYMHQLVEEYATLCDVKNTDKGCTDKQKAFIEKWSGKPGEELTKQLDRLKGMVDKDGGSMKPEALTWAKQRLAIIKQLHKKDEL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.