Basic Information | |
---|---|
Taxon OID | 3300009268 Open in IMG/M |
Scaffold ID | Ga0103874_1013200 Open in IMG/M |
Source Dataset Name | Eukaryotic communities of water from the North Atlantic ocean - ACM43 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Georgia |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 678 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Eukaryotic Communities Of Water From Amazon River, Brazil And North Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pacific Ocean | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006208 | Metatranscriptome | 378 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103874_10132001 | F006208 | N/A | KSASGDQFNDLVQRMMFKAGVTRIGPLTNDEMNNEIETIFAASAGSRGMDRHTFKEVVNSKKMMELRLRKLVAEIEADFWLESKSPYGGDDENISGRDLTTNHTAEEALHLRSFLRTSALVIQFCRRIQMKFSHADVEGSTKAAKALSHLLVRSQEELYEEIQRVKSMSGSNGYGSGAKYARSRGKRRTGSDNY* |
⦗Top⦘ |