Scaffold Ga0103872_1013585

Overview

Basic Information

• Taxon OID: 3300009263
• Scaffold ID: Ga0103872_1013585
• Source Dataset Name: Eukaryotic communities of water from the North Atlantic ocean - ACM27
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Georgia
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 891
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Eukaryotic Communities Of Water From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location

• Location Name: North Pacific Ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027855	Metagenome / Metatranscriptome	193	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103872_10135851	F027855	N/A	MREEESSSDSDSSDDEANVQTQDCKFYPCVIEKHPKYNAWESIKDGAANDKYERMPIAHFSADSDDIFMRSMVKKYAFEKRTPIEQLEDGTKIGGEPTGSFWMGKKDMMYAAKEVLKDHKGLSGDKLQSYLDTYFDRAWENFDPNGDGEIEVIKSPQFMRFLASDQGMSLGENGEDAGEIKAFNDLRAKMAEK*