Basic Information | |
---|---|
Taxon OID | 3300009216 Open in IMG/M |
Scaffold ID | Ga0103842_1003599 Open in IMG/M |
Source Dataset Name | Microbial communities of water from the North Atlantic ocean - ACM47 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Georgia |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1011 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water → Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pacific Ocean | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008476 | Metatranscriptome | 332 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103842_10035991 | F008476 | N/A | LLLGLLAALTNGQGSAMKEIMEGIDMYNFRARCWGEANVDKQIAALETAKKICSQVASPLERFGSFARVRPFFASRRQDHANNILSVLQSGGDLSNVGSLWRNKRDTFDFDSINRFSDGNGITNPDEEDILEFLDQFADFKSNVASRMGNLTCVLKEMKMMTPDNKINIDAYTSDLGGESSFGMDFNIKGSAVSDPEWRRKFSEGSRDCYKLAQNWPQSSLNKNPITRLFGRHMIFFRCADKTERKLCSEAQLFHGLEKLYGSLDSDELAERLDKLGLPEDKYDAAAITVAVMHHAASEEEKFVDRFMWAMNDHGHM* |
⦗Top⦘ |