Basic Information | |
---|---|
Taxon OID | 3300009210 Open in IMG/M |
Scaffold ID | Ga0103761_1026825 Open in IMG/M |
Source Dataset Name | Planktonic communities from eutrophic pond at the campus Essen of the University Duisburg-Essen, Germany - sample 2-1 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Duisburg-Essen |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 659 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Eutrophic Pond → Planktonic Communities From Eutrophic Pond At The Campus Essen Of The University Duisburg-essen, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | University Duisburg-Essen, Germany | |||||||
Coordinates | Lat. (o) | 51.46 | Long. (o) | 7.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005209 | Metatranscriptome | 408 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103761_10268251 | F005209 | N/A | MAAHSQVTVLVFVVMAALLQPKFVTAAGRADAVRKMIAARNLEVAGLPDPTCATGVIAMKVGDTPQVCCAGYCGECSDYPTCMSVRGQNSTNACCKTQVYEMRCGNAPANVCLKPCTESVPPCIMEDGKTFTTPDPSARTAGQDCNKAVADWRQKAVAATKPQQSK* |
⦗Top⦘ |