Scaffold Ga0103748_10038447

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103748_10038447

Scaffold Ga0103748_10038447

Overview

Basic Information
Taxon OID	3300009199 Open in IMG/M
Scaffold ID	Ga0103748_10038447 Open in IMG/M
Source Dataset Name	Microbial communities of wastewater sludge from Singapore - Sludge7_b2_February
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	788
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge → Microbial Communities Of Wastewater Sludge From Singapore

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.2	Long. (^o)	103.45	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032274	Metagenome / Metatranscriptome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103748_100384472	F032274	GAGG	LISFDFTEQTEIVKREKRKHLEARQDWQRAPKIIVTEEYIALDKKLEPIEEELFDLIKKMPLAIEKKIKGKICVIPSGLKTDEELISRVRELRKQASKIGKELDALFFKTNPEWAKFYEYTDKT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.