Scaffold Ga0114971_10616720

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114971_10616720

Scaffold Ga0114971_10616720

Overview

Basic Information
Taxon OID	3300009185 Open in IMG/M
Scaffold ID	Ga0114971_10616720 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	599
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location Name	Lake Montjoie, Canada
Coordinates	Lat. (^o)	45.4091	Long. (^o)	-72.0994	Alt. (m)		Depth (m)	6
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062693	Metagenome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114971_106167202	F062693	N/A	MSKLILTIDEEDLNIFKKQYINLVDLHDEIEKLFEEGKKLDKRKKKVYADWKEKINFLITMYNARATFKTYNKVK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.