Basic Information | |
---|---|
Taxon OID | 3300009176 Open in IMG/M |
Scaffold ID | Ga0105242_10934902 Open in IMG/M |
Source Dataset Name | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 870 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Michigan, USA | |||||||
Coordinates | Lat. (o) | 42.3948 | Long. (o) | -85.3738 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F072767 | Metagenome | 121 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105242_109349021 | F072767 | GGA | MTSSSAARRIPLDLAKRTGFLLGFLFICLFLSPARASDDLQEIKRCRSIIAEAAFLVELWSQGDLTDIFARGLLETAQEQLASSVDNPGLDARVRDELKSASAAIESRDAGALRQISNELYARKRQG* |
⦗Top⦘ |