Scaffold Ga0073936_10072937

Overview

Basic Information

• Taxon OID: 3300009175
• Scaffold ID: Ga0073936_10072937
• Source Dataset Name: Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2977
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Finland: Lake Alinen Mustajarvi
• Coordinates
  • Lat. (^o): 61.5637
  • Long. (^o): 22.044
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084004	Metagenome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0073936_100729375	F084004	N/A	MRLLDIAAFGASARQNPQEGFIMERCMRTTVAILVLLAAGGLAARAGNDSLEFVYDCFIARFADGNPAWKTEITLEADLNKPPRPPYRLHYDDSLGYYTYRPKHWSELNDYERFALRNDPRLSDFIRQNADSLRNGQFGVFAGSTNATRAALKPGAGASAQNNNARTGPLEHAPAAEATSADSQNAGVLTQEGENRWGYRFEPGDLLNSKPLRLVEVAP*