Scaffold Ga0114996_10035599

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114996_10035599

Scaffold Ga0114996_10035599

Overview

Basic Information
Taxon OID	3300009173 Open in IMG/M
Scaffold ID	Ga0114996_10035599 Open in IMG/M
Source Dataset Name	Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4693
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (58.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location Name	Arctic Ocean: Canada Basin
Coordinates	Lat. (^o)	75.2588	Long. (^o)	-156.0227	Alt. (m)		Depth (m)	208
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065695	Metagenome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114996_100355993	F065695	GAG	MSFGGQNSSSGVSAHVHSNAVGEGGALSTSDTLLDTSNIYTRIIVGA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.