Scaffold Ga0113563_13591092

Overview

Basic Information

• Taxon OID: 3300009167
• Scaffold ID: Ga0113563_13591092
• Source Dataset Name: Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 525
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands → Freshwater Wetland Microbial Communities From Ohio, Usa, Analyzing The Effect Of Biotic And Abiotic Controls

Source Dataset Sampling Location

• Location Name: USA: Ohio, Lake Erie, Old Woman Creek
• Coordinates
  • Lat. (^o): 41.384
  • Long. (^o): -82.513
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031715	Metagenome / Metatranscriptome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0113563_135910921	F031715	N/A	RDFNPNLHSIRDEPEFKAVFADIERDMARQRAELAARPKNAPLDLAPGH*