Scaffold Ga0114918_10133920

Overview

Basic Information

• Taxon OID: 3300009149
• Scaffold ID: Ga0114918_10133920
• Source Dataset Name: Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1496
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 58.622
  • Long. (^o): 18.254
  • Depth (m): 437

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096216	Metagenome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0114918_101339201	F096216	N/A	MRIPKSLKEVLVKDYIQINKIRSAEYDNPFTRTIDLLCIFNDRDYVLKQKPSEIAVDLSHLLVEPSRVLKQYFTINGKRYGIVNHINDLEAGQYMSF