NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114918_10082931

Scaffold Ga0114918_10082931


Overview

Basic Information
Taxon OID3300009149 Open in IMG/M
Scaffold IDGa0114918_10082931 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2033
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (30.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)58.622Long. (o)18.254Alt. (m)Depth (m)437
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027756Metagenome / Metatranscriptome193N
F036564Metagenome / Metatranscriptome169N
F044916Metagenome / Metatranscriptome153Y
F064403Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
Ga0114918_100829315F044916N/AMGKKKVDKSRIEKGIEKEEKTFALMAKKIVDAIKDEKELRIFAKTSLEMLYKDNPNLFADHTKLKLKKK*
Ga0114918_100829316F064403GGAGMTKGIIRHIEPREMILTKLKQSYLKEHPATLVDRILGYLNNLTDFQLCELYSEKYETNPKYIAEQFEFNF*
Ga0114918_100829317F036564N/AMKIRQNKKMKLGRIYLDLKYIVDMDNDDMVAHAIEALYEDLMQGVKYGNITDWIDVVEDKNATEDMIPEFLLEKEND*
Ga0114918_100829318F027756N/AMKIEDLVDRKILYVNYPINKFAVQEGKVSEISPSKKCIKINSDWHIADNIRIIELFSENERPKLGFGLTKI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.