Scaffold Ga0118735_10138198

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0118735_10138198

Scaffold Ga0118735_10138198

Overview

Basic Information
Taxon OID	3300009136 Open in IMG/M
Scaffold ID	Ga0118735_10138198 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	774
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location
Location Name	Hudson Canyon, US Atlantic Margin
Coordinates	Lat. (^o)	39.54345	Long. (^o)	-72.3998	Alt. (m)		Depth (m)	541
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012508	Metagenome / Metatranscriptome	280	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118735_101381983	F012508	GAGG	MSKIKEEMLGYDHEPSDWIDESAHVMVDELIEYQVYCMTLSELTARVVKQMRDEYYSNSYDEMTKQYNEAFPNE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.