Scaffold Ga0118735_10130885

Overview

Basic Information

• Taxon OID: 3300009136
• Scaffold ID: Ga0118735_10130885
• Source Dataset Name: Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 794
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location

• Location Name: Hudson Canyon, US Atlantic Margin
• Coordinates
  • Lat. (^o): 39.54345
  • Long. (^o): -72.3998
  • Depth (m): 541

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009787	Metagenome	313	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118735_101308852	F009787	N/A	MKVIYIICVLTLFSCSAKYHYNKALKRGLQVTQTSDTIRIATIDSIPVIKHDTIVYERIISSKDTIVYYKNIIVPKTRLETRIEYKLKRDTLRMITRVEVQKAKAQAKANKKPNYWWMLIFALVFGAVMFLLNKLISKII*