NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0118736_10227437

Scaffold Ga0118736_10227437


Overview

Basic Information
Taxon OID3300009135 Open in IMG/M
Scaffold IDGa0118736_10227437 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsf
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)592
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location
Location NameHudson Canyon, US Atlantic Margin
CoordinatesLat. (o)39.54345Long. (o)-72.3998Alt. (m)Depth (m)541
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045851Metagenome / Metatranscriptome152Y
F046001Metagenome / Metatranscriptome152N

Sequences

Protein IDFamilyRBSSequence
Ga0118736_102274371F046001N/AMTKIKFNTNYKTINQVTNSNKLNRPVHIMPDGLYVDNTDIETVTKILDRELIKYKLK*
Ga0118736_102274372F045851N/AMTLQDHNTINELIKFYQKNRNESDYKKGIQPIEGHKIDKLMMSNHLMGAKLDLNIYSVSYTHLRAHET*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.