Scaffold Ga0118729_1209005

Overview

Basic Information

• Taxon OID: 3300009130
• Scaffold ID: Ga0118729_1209005
• Source Dataset Name: Combined Assembly of Gp0139511, Gp0139512
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Genomics Facility
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 784
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location

• Location Name: Cariaco Basin, Venezuela
• Coordinates
  • Lat. (^o): 10.5
  • Long. (^o): -64.66
  • Depth (m): 103

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105867	Metagenome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0118729_12090053	F105867	N/A	RERFIYHATTLMTMSNLGRLTKTSLNKKLETMRNNRCKNLLDKQIEEIFLDVEHETLAMMRNAQEKLAKSCAKRQGYKKREFAEDVQEDFK*