Scaffold Ga0118687_10170089

Overview

Basic Information

• Taxon OID: 3300009124
• Scaffold ID: Ga0118687_10170089
• Source Dataset Name: Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 785
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location

• Location Name: Hudson Canyon, US Atlantic Margin
• Coordinates
  • Lat. (^o): 39.54345
  • Long. (^o): -72.3998
  • Depth (m): 541.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078662	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0118687_101700892	F078662	N/A	QSDTWLNTLKQRVADAVLSGAVTTSFTNASQSGSREQVLPTAELSAQLTDVLFEKGLVSGTKPSRMTFARFTR*