NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0118674_1076036

Scaffold Ga0118674_1076036


Overview

Basic Information
Taxon OID3300009122 Open in IMG/M
Scaffold IDGa0118674_1076036 Open in IMG/M
Source Dataset NameSyntrophic microbial communities from biogas reactors in Seattle, WA - R1.C13.But.B IBDA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)767
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge → Syntrophic Microbial Communities From Biogas Reactors In Seattle, Wa

Source Dataset Sampling Location
Location NameSeattle, WA
CoordinatesLat. (o)47.652555Long. (o)-122.304991Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051949Metagenome / Metatranscriptome143N

Sequences

Protein IDFamilyRBSSequence
Ga0118674_10760362F051949GGAGGMFAHAGTARLDIFTDSLLLVVGEDLFLARLSRLSPLMQGRAAYCPLSRRYQGTAGHYCDVEQGIGLRRSKPGAALIFVDQGTIYSIPVV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.