Scaffold Ga0118671_1001403

Overview

Basic Information

• Taxon OID: 3300009121
• Scaffold ID: Ga0118671_1001403
• Source Dataset Name: Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C12.But.A IDBA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 14694
• Total Scaffold Genes: 21
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 13 (61.90%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge → Syntrophic Microbial Communities From Biogas Reactors In Seattle, Wa

Source Dataset Sampling Location

• Location Name: Seattle, WA
• Coordinates
  • Lat. (^o): 47.652555
  • Long. (^o): -122.304991

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103319	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0118671_10014035	F103319	GGAGG	MADQYNSIGHHPKSTYMTSEGHALHNISGLDLIIDIAGVYFPLRSINYAANHNVTDEHGTGTHDPVALTNQEHTYTGTFTYASFLVTGENVLTQKDVLTLTQLLQDQADEGVSKYFDIYIIEVQGKRTPGTGTTFEEQVEAALQNESMVGYIEALVDCKVTKVNRDVPEKNTVVSSREFKYSYKLPR*