Scaffold Ga0117941_1013035

Overview

Basic Information

• Taxon OID: 3300009120
• Scaffold ID: Ga0117941_1013035
• Source Dataset Name: Lake sediment microbial communities from Tanners Lake, St. Paul, MN
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Minnesota - Twin Cities
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2216
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium TMED75 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment → Freshwater Sediment Microbial Communities

Source Dataset Sampling Location

• Location Name: Tanners Lake, St. Paul, MN
• Coordinates
  • Lat. (^o): 44.953471
  • Long. (^o): -92.97875

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005388	Metagenome / Metatranscriptome	402	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0117941_10130352	F005388	N/A	MSCPNVFNAFAVATESLAQDVYKRASYRSMWLNLIERGEYPQGTGLTQTSFTTTSIEPTAAEEWSAITLASGNPGDNGGACDVTYNDVPVGYNAVTWGPERFALKGPLLCKDDLTFDHRVEAFLRVYLEKLSIRAQRSWETRYQNMFAKYAIKAVADSSFTQVETIPSGVNELPWIQTGSVGQALNQATSELTQEMLDVAAATLIRNGATNPDSSGFISFSSDGPVFPLYIGMEASQRIAQNNAALREDLRFADMGSGPGAELLKRIGANRVIKNFRHIPNLFPPRFSYAGGKYTLIQPFTSSSGTKGTVFSVNPSWTTALYEGAFVPTPYVIKSHIVRPVNRVGDLSWQPTNYMGEWQWVTGAYKLDVDCADPLEKKGQHYAEFVHAIEPVFTNQGMTIIFRRCTGALTQIICS*