Scaffold Ga0117938_105508

Overview

Basic Information

• Taxon OID: 3300009119
• Scaffold ID: Ga0117938_105508
• Source Dataset Name: Lake sediment microbial communities from Leach Lake, MN
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Minnesota - Twin Cities
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 888
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment → Freshwater Sediment Microbial Communities

Source Dataset Sampling Location

• Location Name: Leech Lake, MN
• Coordinates
  • Lat. (^o): 47.18868
  • Long. (^o): -94.626271

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045183	Metagenome / Metatranscriptome	153	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0117938_1055081	F045183	N/A	MRLVRAVELHSEATAMKLKDTLKRWINRLLHPALRDSEIIKTLSGLPGVRPFLYEFKLGPLFLISAWLFLFHANYTGAAEDWILYFFGGLTVVGVLSLHKSVMRFLYRIAQFDKPVEGQDRTIMITAETVTLLGFLMAAMIFLNEFQSTGFGM*