Basic Information | |
---|---|
Taxon OID | 3300009119 Open in IMG/M |
Scaffold ID | Ga0117938_105169 Open in IMG/M |
Source Dataset Name | Lake sediment microbial communities from Leach Lake, MN |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Minnesota - Twin Cities |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 908 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment → Freshwater Sediment Microbial Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Leech Lake, MN | |||||||
Coordinates | Lat. (o) | 47.18868 | Long. (o) | -94.626271 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F080207 | Metagenome | 115 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0117938_1051693 | F080207 | GAG | MTMRKTSIVIALCLVLVGTLTATAGATATPTDGSAIQRFDIAVGDYKYGELAVDTETDHVFAYANVGSESADKQVTLVARKDRSSPHTIDIAHSIVNSDGQVFWKGTLTAAQLDWIHTYGGRAVFFFRVNHSLF* |
⦗Top⦘ |