Basic Information | |
---|---|
Taxon OID | 3300009118 Open in IMG/M |
Scaffold ID | Ga0117940_111765 Open in IMG/M |
Source Dataset Name | Lake sediment microbial communities from Pelican Lake, MN |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Minnesota - Twin Cities |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 633 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment → Freshwater Sediment Microbial Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pelican Lake, Minnesota, USA | |||||||
Coordinates | Lat. (o) | 46.612069 | Long. (o) | -94.156828 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045836 | Metagenome / Metatranscriptome | 152 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0117940_1117651 | F045836 | AGGA | MDNPNLFTALAYYTVSGFLDPIQWLICGICGWSVERLDQAMIAGAAMVSVLYIAMAAFYPDGKLFSFPTPHVGIAILGKAIGAVL |
⦗Top⦘ |