Scaffold Ga0117940_111765

Overview

Basic Information

• Taxon OID: 3300009118
• Scaffold ID: Ga0117940_111765
• Source Dataset Name: Lake sediment microbial communities from Pelican Lake, MN
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Minnesota - Twin Cities
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 633
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment → Freshwater Sediment Microbial Communities

Source Dataset Sampling Location

• Location Name: Pelican Lake, Minnesota, USA
• Coordinates
  • Lat. (^o): 46.612069
  • Long. (^o): -94.156828

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045836	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0117940_1117651	F045836	AGGA	MDNPNLFTALAYYTVSGFLDPIQWLICGICGWSVERLDQAMIAGAAMVSVLYIAMAAFYPDGKLFSFPTPHVGIAILGKAIGAVL