Scaffold Ga0117902_1006512

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0117902_1006512

Scaffold Ga0117902_1006512

Overview

Basic Information
Taxon OID	3300009104 Open in IMG/M
Scaffold ID	Ga0117902_1006512 Open in IMG/M
Source Dataset Name	Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Georgia Genomics Facility
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	18495
Total Scaffold Genes	36 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	25 (69.44%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location Name	Cariaco Basin, Venezuela
Coordinates	Lat. (^o)	10.5	Long. (^o)	-64.66	Alt. (m)		Depth (m)	143
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034350	Metagenome	175	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0117902_100651214	F034350	GGA	MSRHIEAAEVVLAGLDAPNVVLAENLRGLARAWDVIERTGDGLGNVANISNQMLRVLDQLGVDDGADDWDRLLADLDAKQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.