Scaffold Ga0114948_10204337

Overview

Basic Information

• Taxon OID: 3300009102
• Scaffold ID: Ga0114948_10204337
• Source Dataset Name: Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1415
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Mariana Trench
• Coordinates
  • Lat. (^o): 12.4764
  • Long. (^o): 144.8648
  • Depth (m): 7939

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035771	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114948_102043373	F035771	AGG	MSQALSRGGNVEKSRQRRSRPFAVLTYYEYAPRVKMAAALLD