NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0111539_10149777

Scaffold Ga0111539_10149777


Overview

Basic Information
Taxon OID3300009094 Open in IMG/M
Scaffold IDGa0111539_10149777 Open in IMG/M
Source Dataset NamePopulus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2731
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Motilibacterales → Motilibacteraceae → Motilibacter → Motilibacter deserti(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location NameUSA: Tennessee
CoordinatesLat. (o)35.8444Long. (o)-83.9599Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015020Metagenome / Metatranscriptome258Y
F069799Metagenome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0111539_101497771F069799AGGMEHYRRSYQITDPERALGPEPHNAPQRADRQRARTAIERVQAKQRAAERARDAQPSSRPPPHQQRGRPGPERAAG*
Ga0111539_101497772F015020AGGAGMASSQPWPFDDEDRPSGSVRPLSQADLQAILAHLGDDPDQLLASTNTGFPVVAMRVRASVGRPGGSAQARWRQERAAEWAVWTRSLPWRVAATLGVGAGGESSAACWRHG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.