Basic Information | |
---|---|
Taxon OID | 3300009039 Open in IMG/M |
Scaffold ID | Ga0105152_10104315 Open in IMG/M |
Source Dataset Name | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1153 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Russia: Lake Baikal | |||||||
Coordinates | Lat. (o) | 53.7598 | Long. (o) | 107.9791 | Alt. (m) | Depth (m) | 0 to .05 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066594 | Metagenome / Metatranscriptome | 126 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105152_101043154 | F066594 | N/A | LNKHPKLYIAAQEQLFAKFQSRSIQIQHWSKYLMTPKELSLLFLKLEESKSALQQIAITDLGESGEIARKQLGIQ* |
⦗Top⦘ |