NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103682_10486964

Scaffold Ga0103682_10486964


Overview

Basic Information
Taxon OID3300009031 Open in IMG/M
Scaffold IDGa0103682_10486964 Open in IMG/M
Source Dataset NameMicrobial communities from groundwater in Rifle, Colorado, USA - 3D_0.1um
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterLawrence Berkeley National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)638
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater → Microbial Communities From Groundwater In Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, CO, USA
CoordinatesLat. (o)39.32Long. (o)-107.46Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002400Metagenome / Metatranscriptome563Y

Sequences

Protein IDFamilyRBSSequence
Ga0103682_104869641F002400GAGGMPIKKKSSRPAACAHCAGTDLVRRIATYPVHLTGPLEGKQIHVGRVALYECQSCGSLMPTPAGRAKVERNLAMGIRLFLGQFP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.