NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103682_10256900

Scaffold Ga0103682_10256900


Overview

Basic Information
Taxon OID3300009031 Open in IMG/M
Scaffold IDGa0103682_10256900 Open in IMG/M
Source Dataset NameMicrobial communities from groundwater in Rifle, Colorado, USA - 3D_0.1um
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterLawrence Berkeley National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)906
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater → Microbial Communities From Groundwater In Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, CO, USA
CoordinatesLat. (o)39.32Long. (o)-107.46Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030143Metagenome / Metatranscriptome186Y
F056343Metagenome / Metatranscriptome137N

Sequences

Protein IDFamilyRBSSequence
Ga0103682_102569001F030143N/ALASQGHDLYRLIDGYPALMVKGLLAAAQVRSRHRLMEQGVALTMAVTGALDLAFNQGKGKVLERWLKEMSGEEKSEPPEERPKMSDRAFSFFASMPRQGPD
Ga0103682_102569002F056343AGGAGMPEPITDSQVLSSYLAEEQISGFTVKPWTIKQLLLVMPILDALVQEFKTQGVTLDNLGEMFESQGLAAAKDIIQTILPRLPEFLAITLKIDREQAEELDLGLGMQLAVKVLRMNIDHLKNAFGLIMSQMGVLIGPEATP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.