Scaffold Ga0103682_10069666

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103682_10069666

Scaffold Ga0103682_10069666

Overview

Basic Information
Taxon OID	3300009031 Open in IMG/M
Scaffold ID	Ga0103682_10069666 Open in IMG/M
Source Dataset Name	Microbial communities from groundwater in Rifle, Colorado, USA - 3D_0.1um
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Lawrence Berkeley National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1920
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater → Microbial Communities From Groundwater In Rifle, Colorado, Usa

Source Dataset Sampling Location
Location Name	Rifle, CO, USA
Coordinates	Lat. (^o)	39.32	Long. (^o)	-107.46	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065251	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103682_100696662	F065251	N/A	MYLRFFKKGRKKYYYIAKAVRKGVRVIQKSILYVGTADTLYEKLVKLKKRA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.