Scaffold Ga0114950_10523097

Overview

Basic Information

• Taxon OID: 3300009030
• Scaffold ID: Ga0114950_10523097
• Source Dataset Name: Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 947
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Kermadec Trench
• Coordinates
  • Lat. (^o): -32.8507
  • Long. (^o): -177.6629
  • Depth (m): 9177

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089413	Metagenome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0114950_105230972	F089413	N/A	MRDTTQTNLRNQGIAIAEVRGTLQVLAANTLNNKQHIQERIAIAEQKLTEVQNRLTEAEFSEPIEWLEDKAGVDA*