Scaffold Ga0066793_10002079

Overview

Basic Information

• Taxon OID: 3300009029
• Scaffold ID: Ga0066793_10002079
• Source Dataset Name: Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 9442
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location

• Location Name: Alaska, USA
• Coordinates
  • Lat. (^o): 68.6139
  • Long. (^o): -149.3145

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040820	Metagenome / Metatranscriptome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066793_100020793	F040820	AGG	VGLAAIACGGSAPATSTRAYPESGLVLLSLADGTQRGSGSIGTDVVAVIVSDDGKTAYVADSSPGDVYAVRLPGLQVAWKQHVGGAPFGLLLHGGRLFVSLFDTTSVVELALSSGIKLATHPVPQGPAAMTIDAAGHVVVAGTRGQLNIIDGGPLAAGNGFGVAFAGGQLWSADYERAELVPAGDDHRVGMPAPLFPFWLAPGTGDTLLVAAEGGTEDTDPGGVFSFDTMTGAFITLATPKDPDQVLQSGSTIFVSAHGERDVLAIQDGRSSAWAKGASAVALAPDPALGVLVVAVNAHE