Scaffold Ga0103708_100147763

Overview

Basic Information

• Taxon OID: 3300009028
• Scaffold ID: Ga0103708_100147763
• Source Dataset Name: Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Woods Hole Oceanographic Institution
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 639
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas commoda (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Eukaryotic Communities From Seawater Of The North Pacific Subtropical Gyre

Source Dataset Sampling Location

• Location Name: North Pacific Subtropical Gyre
• Coordinates
  • Lat. (^o): 22.75
  • Long. (^o): -158.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003454	Metatranscriptome	485	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103708_1001477631	F003454	N/A	SHSRKMFFLLLALAIFSSSVSGHGGVLWPPVWQDGVGRPIEELSGHIVMSEPRVRDPNSGVRVRSTKSWLTDQAYTGGVGDEFKGLGPVTNLNNPNARKFDQCRDRCAANTNPWAAPGHAPSLGGGCGIFGGNPDGCPAHKDSRPPGSVCGQEAPLGRGQRGTSSFGTDARLFDFPQMITTEWEIGSEQEVVWTTRGSHKGGYTYRLCKMPKG