Scaffold Ga0115649_1029706

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115649_1029706

Scaffold Ga0115649_1029706

Overview

Basic Information
Taxon OID	3300009008 Open in IMG/M
Scaffold ID	Ga0115649_1029706 Open in IMG/M
Source Dataset Name	Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Georgia Genomics Facility
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9381
Total Scaffold Genes	29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (31.03%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location Name	Cariaco Basin, Venezuela
Coordinates	Lat. (^o)	10.5	Long. (^o)	-64.66	Alt. (m)		Depth (m)	267
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036024	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115649_102970616	F036024	N/A	MGMTTEYRMGRIGNEDTFLELNKAKEMCRKVVGNYISEVEEEDGKYAIDEYNWHIVTTETFEEDWFNDERLKKTGKMKAKYKKLAKNNRVLFFEIDWN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.