Scaffold Ga0103502_10106139

Overview

Basic Information

• Taxon OID: 3300008998
• Scaffold ID: Ga0103502_10106139
• Source Dataset Name: Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1002
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera → Apocrita → Parasitoida → Chalcidoidea → Trichogrammatidae → Trichogramma → Trichogramma brassicae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053055	Metatranscriptome	141	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103502_101061391	F053055	N/A	KLLLLDSLLQETWRTQLQPVIVVASVEDSETGAGVAAAVAIEAGAVETVVVDVAGARRRRNGSP*