Scaffold Ga0116011_1116113

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116011_1116113

Scaffold Ga0116011_1116113

Overview

Basic Information
Taxon OID	3300008982 Open in IMG/M
Scaffold ID	Ga0116011_1116113 Open in IMG/M
Source Dataset Name	Combined Assembly of De NOVO T5 (live) Tyne Sediment Benzoate Gp0125094, Gp0125095, Gp0125096
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Shell Corporation
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	561
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Source Dataset Sampling Location
Location Name	UK (Newcastle upon Tyne)
Coordinates	Lat. (^o)	54.971158	Long. (^o)	-1.703654	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059489	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116011_11161131	F059489	GGAGG	MTQSNDQHAVDVDTYISKNSRVKSFVYDRGEIRTIAENLGFKTDHVRTELRKLGYSLIKNSSHGRMIWK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.