Scaffold Ga0104241_1002829

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0104241_1002829

Scaffold Ga0104241_1002829

Overview

Basic Information
Taxon OID	3300008953 Open in IMG/M
Scaffold ID	Ga0104241_1002829 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Georgia Institute of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1282
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa

Source Dataset Sampling Location
Location Name	Lake Lanier in Georgia, USA
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103224	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0104241_10028292	F103224	N/A	MIFKKPDPTQKIYHYIEIDSTTIALYDSLLDQPISYGSKVKIQVDINKLLPKDITIYYYTLKELIKKILILYINNLIICA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.