NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104241_1001659

Scaffold Ga0104241_1001659


Overview

Basic Information
Taxon OID3300008953 Open in IMG/M
Scaffold IDGa0104241_1001659 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1708
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa

Source Dataset Sampling Location
Location NameLake Lanier in Georgia, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007359Metagenome / Metatranscriptome352Y
F010746Metagenome / Metatranscriptome299Y
F035200Metagenome / Metatranscriptome172Y

Sequences

Protein IDFamilyRBSSequence
Ga0104241_10016591F007359AGGAMKLIKQNLGAHWVIGIKGNKDEIEQFHNRVYNWGGTNGELQWMSESFAYFWITLEKLERVMFKYVMNSLSDKLGKKFRGAKGGLKAVVMNRVMNTINNIPSEHF
Ga0104241_10016595F035200GGAGMTSKFIVLRDGVRVSEDMHSSEASAEVEANYWREIIKRWPDGTKVIVKKIGG*
Ga0104241_10016596F010746N/AMTYKCAVSGEAIPPERVEALQVLGVPESQWTKIEYSQTRKLKAVYAGDDGSNDIVICDNVDGGSMFDNAVVAETENDI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.