Scaffold Ga0103734_1019696

Overview

Basic Information

• Taxon OID: 3300008931
• Scaffold ID: Ga0103734_1019696
• Source Dataset Name: Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1C
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 971
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica → Eukaryotic And Microbial Communities From Ice Edge, Mcmurdo Sound, Antarctica

Source Dataset Sampling Location

• Location Name: Ice edge, McMurdo Sound, Antarctica
• Coordinates
  • Lat. (^o): -77.36
  • Long. (^o): 164.28

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045520	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103734_10196961	F045520	N/A	MAFNRIYKHIENLIRNDDEVADNIPCKVDILNIRECRKNGKACDDIGLELLRCMAQFKVDTTEKIRTSIGVAKYNEYVKEIEDKHGKEKATEIVSEPKEQLKDIEAYQVLHRLANNVPPKGGAPKTIDEIRNWTYADQVRLEIGEGEYWDSVKIVGYEFGLNKADALFCLSKENDMIESAQTRLAPGLKERKESALSSIKKIGDSVKEAAPSGKTSADFADAFNDLYPSKDDLKAAL*