NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103379_1002118

Scaffold Ga0103379_1002118


Overview

Basic Information
Taxon OID3300008851 Open in IMG/M
Scaffold IDGa0103379_1002118 Open in IMG/M
Source Dataset NameMicrobial communities from dairy cow rumen, for metatranscriptome studies - 6021_control diet
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterAarhus University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)500
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities From Dairy Cow Rumen, For Metatranscriptome Studies

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008062Metagenome / Metatranscriptome340Y

Sequences

Protein IDFamilyRBSSequence
Ga0103379_10021181F008062N/AGGFRLGEGEVPVDEIYAAVVALFKGMAETDEATCAGVLENQKDKILEIVYAAIDEVKAGADVSTAAQNALIKLMGVDGLVSECNVLAMPAIITKVTSKDGLVDIFQALIDNIDDVYSYGEDIKAAFDEKDYNAAAEAFGHILAIALDFQVNL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.