Scaffold Ga0103951_10307988

Overview

Basic Information

• Taxon OID: 3300008832
• Scaffold ID: Ga0103951_10307988
• Source Dataset Name: Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Genoscope
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 819
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094871	Metatranscriptome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103951_103079881	F094871	GGAG	MTGVLGFALVSLLAVSSLPSVTASLTWKEFAFIQSGLGWLALVLLCGHDMFYGWKYMDGPSCGIPSSFQYVLYIPGLTILLKIPLVLPPISSHLDKIRSGYVRSSLISRNNKKKQKKNEIAETV*