Basic Information | |
---|---|
Taxon OID | 3300008811 Open in IMG/M |
Scaffold ID | Ga0103378_1002444 Open in IMG/M |
Source Dataset Name | Microbial communities from dairy cow rumen, for metatranscriptome studies - 2155_rapeseed oil diet |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Aarhus University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 504 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities From Dairy Cow Rumen, For Metatranscriptome Studies |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051988 | Metagenome / Metatranscriptome | 143 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103378_10024441 | F051988 | N/A | NYKLINTLQEGYTGNDMMADLDLSQLAMQGQFHDYRSRVDLFDSYLIHVEANLATKATKSVAVTAYVAGNAASNQFQKGGMIGKWEPNTKMTYINDLLGWYNGIPVLRSTDIKENVGNKEATFYAIIKTQDGQMAPLARGIYMPLTDTPTVGNYNNPTQMASGIYYQ |
⦗Top⦘ |