Scaffold Ga0103638_1005111

Overview

Basic Information

• Taxon OID: 3300008785
• Scaffold ID: Ga0103638_1005111
• Source Dataset Name: Microbial communities from wetland soil in Czech Republic - R1_cDNA
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Friedrich Schiller University of Jena
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 515
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil → Microbial Communities From Wetland Soil In Czech Republic

Source Dataset Sampling Location

• Location Name: Czech Republic
• Coordinates
  • Lat. (^o): 50.14667
  • Long. (^o): 12.45083

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023644	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103638_10051111	F023644	AGGAG	LPLGSPATAVGNHRIKASLRVAAISPARDRMLVTTFRSPTTTSVFTDSIPGSKFLVCHFTSQPAGSTARSALRLRYRTRFAPVPAASLLLARCSLTDPLDRLRLPPPLPSGTFASLGIKAFDWICRPSARLPNPPDFLSLPAA