Basic Information | |
---|---|
Taxon OID | 3300008698 Open in IMG/M |
Scaffold ID | Ga0103619_100289 Open in IMG/M |
Source Dataset Name | Microbial communities of saline water collected from the North Sea in Germany - HE327_3b |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Goettingen Genomics Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1246 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea → Microbial Communities Of Saline Water Collected From The North Sea In Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Sea, Germany | |||||||
Coordinates | Lat. (o) | 54.4223 | Long. (o) | 7.6833 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F012347 | Metagenome / Metatranscriptome | 281 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103619_1002891 | F012347 | AGGA | MNRIKHGNVNKWTSTKAGQVIEFASSKPRHVKFEITANSNIEIWVADNNKMSDAVLVGTSNGKTEIQYTAVATTYVQIKAEKSADVFVNIPDLDQAVENTDNPSFTSIEPRVNNSTEFDRMMTFMKHNEQQRNAQLEAERAALRAEVAKIKAEAETVVEAPVEAETEDAGETPE* |
⦗Top⦘ |