Scaffold Ga0103623_1002992

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103623_1002992

Scaffold Ga0103623_1002992

Overview

Basic Information
Taxon OID	3300008651 Open in IMG/M
Scaffold ID	Ga0103623_1002992 Open in IMG/M
Source Dataset Name	Microbial communities of saline water collected from the North Sea in Germany - HE327_13
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Goettingen Genomics Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1075
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea → Microbial Communities Of Saline Water Collected From The North Sea In Germany

Source Dataset Sampling Location
Location Name	North Sea, Germany
Coordinates	Lat. (^o)	54.4365	Long. (^o)	8.2328	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085721	Metagenome / Metatranscriptome	111	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103623_10029921	F085721	N/A	TDTEIKDRTAGKCFAKINALENSLEYLATQKPYLAYTQDMIDAQISFKRRELTIWNHMALLNETNT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.