Basic Information | |
---|---|
Taxon OID | 3300008572 Open in IMG/M |
Scaffold ID | Ga0103775_104847 Open in IMG/M |
Source Dataset Name | Microbial communities of Cyanobacterial mats from a recreation lake in Champs-sur-Marne, France - CSM2012-AB-F-N |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Centre National de la Recherche Scientifique (CNRS) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 581 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Microbial Communities Of Cyanobacterial Mats From A Recreation Lake In Champs-sur-marne, France |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Champs-sur-Marne, France | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F060948 | Metagenome / Metatranscriptome | 132 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103775_1048471 | F060948 | N/A | ITLIIAVNIMNTFFLNLGKFYWWLFTDKNLNSDTLIRLAYGHYVSAFFLFYLGVLHSFDMHYD* |
⦗Top⦘ |