Scaffold Ga0103775_104196

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103775_104196

Scaffold Ga0103775_104196

Overview

Basic Information
Taxon OID	3300008572 Open in IMG/M
Scaffold ID	Ga0103775_104196 Open in IMG/M
Source Dataset Name	Microbial communities of Cyanobacterial mats from a recreation lake in Champs-sur-Marne, France - CSM2012-AB-F-N
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Centre National de la Recherche Scientifique (CNRS)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	625
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Microbial Communities Of Cyanobacterial Mats From A Recreation Lake In Champs-sur-marne, France

Source Dataset Sampling Location
Location Name	Champs-sur-Marne, France
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038004	Metagenome / Metatranscriptome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103775_1041962	F038004	N/A	MAVKLGSMDTHIVLTALWDYRETLTDFDEAPPNPQVDEKIQRVDRLIKHYKQSFFALDRLGIY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.